PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A09G2132
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 269aa    MW: 31081.9 Da    PI: 7.1135
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A09G2132genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.5e-182269148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd++lv++++ +G g+W++ a   g++Rt+k+c++rw++yl
      Gh_A09G2132 22 RGPWTVEEDLKLVNYIASHGEGRWNSLALFAGLKRTGKSCRLRWLNYL 69
                     89********************************************97 PP

2Myb_DNA-binding51.72.1e-1675118146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
      Gh_A09G2132  75 RGNITLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 118
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.3931773IPR017930Myb domain
SuperFamilySSF466898.24E-3120116IPR009057Homeodomain-like
SMARTSM007175.7E-152171IPR001005SANT/Myb domain
PfamPF002491.4E-162269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-222376IPR009057Homeodomain-like
CDDcd001679.80E-122469No hitNo description
SMARTSM007171.3E-1474122IPR001005SANT/Myb domain
PROSITE profilePS5129418.70774124IPR017930Myb domain
PfamPF002494.2E-1575118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-2377123IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MDAKAKGNVR REEEDDQIEL RRGPWTVEED LKLVNYIASH GEGRWNSLAL FAGLKRTGKS  60
CRLRWLNYLR PDVRRGNITL EEQLLILELH SRWGNRWSKI AQHLPGRTDN EIKNYWRTRV  120
QKHAKQLKCD VNSKQFKDTM RYLWMPRLVE RIQAGIASSS STTATAMGQI GIPQVALSYN  180
TLDNSSTTVS LETQISPISD FSDCYGNIVP INENTNPDYF QASQIGSSND YNHGMDFQPW  240
LRGVDNITSD HFLDCDDFLF LQQQFNFNM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-261912224126MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6191618e-65JX619161.1 Gossypium hirsutum clone NBRI_GE64919 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012487549.11e-174PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE12e-82MY108_ARATH; Transcription factor MYB108
TrEMBLA0A0D2QHD01e-174A0A0D2QHD0_G
STRINGPOPTR_0008s10080.11e-112(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.12e-85myb domain protein 78